Recombinant Human Cell growth-regulating nucleolar protein (LYAR)

Produktübersicht

• Artikelname: Recombinant Human Cell growth-regulating nucleolar protein (LYAR)
• Artikelnummer: CSB-YP882130HU
• Hersteller Artikelnummer: CSB-YP882130HU
• Alternativnummer: CSB-YP882130HU-1, CSB-YP882130HU-100, CSB-YP882130HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Cell growth regulating nucleolar protein, Cell growth-regulating nucleolar protein, Likely ortholog of mouse Ly1 reactive clone , Ly1 reactive, Ly1 reactive homolog (mouse) , Ly1 reactive homolog, LYAR, LYAR_HUMAN, ZC2HC2, ZLYAR

Produkteigenschaften

• Molekulargewicht: 45.6 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q9NX58
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 1-379aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MVFFTCNACGESVKKIQVEKHVSVCRNCECLSCIDCGKDFWGDDYKNHVKCISEDQKYGGKGYEGKTHKGDIKQQAWIQKISELIKRPNVSPKVRELLEQISAFDNVPRKKAKFQNWMKNSLKVHNESILDQVWNIFSEASNSEPVNKEQDQRPLHPVANPHAEISTKVPASKVKDAVEQQGEVKKNKRERKEERQKKRKREKKELKLENHQENSRNQKPKKRKKGQEADLEAGGEEVPEANGSAGKRSKKKKQ