Recombinant Human Chitinase domain-containing protein 1 (CHID1)

Produktübersicht

• Artikelname: Recombinant Human Chitinase domain-containing protein 1 (CHID1)
• Artikelnummer: CSB-YP883614HU
• Hersteller Artikelnummer: CSB-YP883614HU
• Alternativnummer: CSB-YP883614HU-1, CSB-YP883614HU-100, CSB-YP883614HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Stabilin-1-interacting chitinase-like protein Short name: SI-CLP

Produkteigenschaften

• Molekulargewicht: 44.8 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q9BWS9
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 20-393aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: TLSKSDAKKAASKTLLEKSQFSDKPVQDRGLVVTDLKAESVVLEHRSYCSAKARDRHFAGDVLGYVTPWNSHGYDVTKVFGSKFTQISPVWLQLKRRGREMFEVTGLHDVDQGWMRAVRKHAKGLHIVPRLLFEDWTYDDFRNVLDSEDEIEELSKTVVQVAKNQHFDGFVVEVWNQLLSQKRVGLIHMLTHLAEALHQARLLALLVIPPAITPGTDQLGMFTHKEFEQLAPVLDGFSLMTYDYSTAHQPGPNA