Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 6 (LGR6), partial

Produktübersicht

• Artikelname: Recombinant Human Leucine-rich repeat-containing G-protein coupled receptor 6 (LGR6), partial
• Artikelnummer: CSB-YP884515HU
• Hersteller Artikelnummer: CSB-YP884515HU
• Alternativnummer: CSB-YP884515HU-1, CSB-YP884515HU-100, CSB-YP884515HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide

Produkteigenschaften

• Molekulargewicht: 62.2 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: Q9HBX8
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 25-567aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: APQPGPGPTACPAPCHCQEDGIMLSADCSELGLSAVPGDLDPLTAYLDLSMNNLTELQPGLFHHLRFLEELRLSGNHLSHIPGQAFSGLYSLKILMLQNNQLGGIPAEALWELPSLQSLRLDANLISLVPERSFEGLSSLRHLWLDDNALTEIPVRALNNLPALQAMTLALNRISHIPDYAFQNLTSLVVLHLHNNRIQHLGTHSFEGLHNLETLDLNYNKLQEFPVAIRTLGRLQELGFHNNNIKAIPEKAFM