Recombinant Mouse Thioredoxin domain-containing protein 12 (Txndc12)
Artikelnummer:
CSB-YP887432MO
- Bilder (0)
| Artikelname: | Recombinant Mouse Thioredoxin domain-containing protein 12 (Txndc12) |
| Artikelnummer: | CSB-YP887432MO |
| Hersteller Artikelnummer: | CSB-YP887432MO |
| Alternativnummer: | CSB-YP887432MO-1, CSB-YP887432MO-100, CSB-YP887432MO-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | Endoplasmic reticulum resident protein 19 Short name: ER protein 19 Short name: ERp19 Thioredoxin-like protein p19 |
| Molekulargewicht: | 18.5 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q9CQU0 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 25-170aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | RTGLGKGFGDHIHWRTLEDGKKEAAASGLPLMVIIHKSWCGACKALKPKFAESTEISELSHNFVMVNLEDEEEPRDEDFSPDGGYIPRILFLDPSGKVRPEIINESGNPSYKYFYVSAEQVVQGMKEAQERLTGDAFREKHFQDEL |
Produktgarantie und fachkundiger Support
