Recombinant Human Iron-sulfur cluster assembly enzyme ISCU, mitochondrial (ISCU)

Artikelnummer: CSB-YP887955HU
Artikelname: Recombinant Human Iron-sulfur cluster assembly enzyme ISCU, mitochondrial (ISCU)
Artikelnummer: CSB-YP887955HU
Hersteller Artikelnummer: CSB-YP887955HU
Alternativnummer: CSB-YP887955HU-1, CSB-YP887955HU-100, CSB-YP887955HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: NifU-like N-terminal domain-containing protein (NifU-like protein) (NIFUN),CSB-PR2024
Molekulargewicht: 27.5 kDa
Tag: N-terminal 6xHis-sumostar-tagged
UniProt: Q9H1K1
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 35-167aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: YHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK