Recombinant Human Interferon kappa (IFNK)

Produktübersicht

• Artikelname: Recombinant Human Interferon kappa (IFNK)
• Artikelnummer: CSB-YP889172HUK3
• Hersteller Artikelnummer: CSB-YP889172HUk3
• Alternativnummer: CSB-YP889172HUK3-1, CSB-YP889172HUK3-100, CSB-YP889172HUK3-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: (IFN-kappa)

Produkteigenschaften

• Molekulargewicht: 80.1 kDa
• Tag: C-terminal 6xHis-PDI-tagged
• UniProt: Q9P0W0
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 28-207aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: LDCNLLNVHLRRVTWQNLRHLSSMSNSFPVECLRENIAFELPQEFLQYTQPMKRDIKKAFYEMSLQAFNIFSQHTFKYWKERHLKQIQIGLDQQAEYLNQCLEEDKNENEDMKEMKENEMKPSEARVPQLSSLELRRYFHRIDNFLKEKKYSDCAWEIVRVEIRRCLYYFYKFTALFRRK