Recombinant Human Methyl-CpG-binding domain protein 2 (MBD2), partial
Artikelnummer:
CSB-YP890654HU1
- Bilder (0)
| Artikelname: | Recombinant Human Methyl-CpG-binding domain protein 2 (MBD2), partial |
| Artikelnummer: | CSB-YP890654HU1 |
| Hersteller Artikelnummer: | CSB-YP890654HU1 |
| Alternativnummer: | CSB-YP890654HU1-1, CSB-YP890654HU1-100, CSB-YP890654HU1-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | (Demethylase)(DMTase)(Methyl-CpG-binding protein MBD2) |
| Molekulargewicht: | 56.3 kDa |
| Tag: | C-terminal hFc-tagged |
| UniProt: | Q9UBB5 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 145-411aa |
| Reinheit: | Greater than 85% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | ESGKRMDCPALPPGWKKEEVIRKSGLSAGKSDVYYFSPSGKKFRSKPQLARYLGNTVDLSSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKGKPDLNTTLPIRQTASIFKQPVTKVTNHPSNKVKSDPQRMNEQPRQLFWEKRLQGLSASDVTEQIIKTMELPKGLQGVGPGSNDETLLSAVASALHTSSAPITGQVSAAVEKNPAVWLNTSQPLCKAFIVTDEDIRKQEERVQQVRKKLEEALMADILSRAADT |
Produktgarantie und fachkundiger Support
