Recombinant Human Protein-arginine deiminase type-3 (PADI3)

Produktübersicht

• Artikelname: Recombinant Human Protein-arginine deiminase type-3 (PADI3)
• Artikelnummer: CSB-YP891552HU
• Hersteller Artikelnummer: CSB-YP891552HU
• Alternativnummer: CSB-YP891552HU-1, CSB-YP891552HU-100, CSB-YP891552HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Peptidylarginine deiminase III Protein-arginine deiminase type III

Produkteigenschaften

• Molekulargewicht: 76.7 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q9ULW8
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 1-664aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MSLQRIVRVSLEHPTSAVCVAGVETLVDIYGSVPEGTEMFEVYGTPGVDIYISPNMERGRERADTRRWRFDATLEIIVVMNSPSNDLNDSHVQISYHSSHEPLPLAYAVLYLTCVDISLDCDLNCEGRQDRNFVDKRQWVWGPSGYGGILLVNCDRDDPSCDVQDNCDQHVHCLQDLEDMSVMVLRTQGPAALFDDHKLVLHTSSYDAKRAQVFHICGPEDVCEAYRHVLGQDKVSYEVPRLHGDEERFFVEGL