Recombinant Human ATP-binding cassette sub-family G member 2 (ABCG2), partial

Produktübersicht

• Artikelname: Recombinant Human ATP-binding cassette sub-family G member 2 (ABCG2), partial
• Artikelnummer: CSB-YP891568HU1
• Hersteller Artikelnummer: CSB-YP891568HU1
• Alternativnummer: CSB-YP891568HU1-1, CSB-YP891568HU1-100, CSB-YP891568HU1-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: ATP-binding cassette sub-family G member 2 Breast cancer resistance protein CDw338 Mitoxantrone resistance-associated protein Placenta-specific ATP-binding cassette transporter Urate exporter CD_antigen: CD338,CSB-PR2024

Produkteigenschaften

• Molekulargewicht: 12.1 kDa
• Tag: C-terminal 6xHis-Myc-tagged
• UniProt: Q9UNQ0
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 557-630aa
• Reinheit: Greater than 85% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: NLTTIASWLSWLQYFSIPRYGFTALQHNEFLGQNFCPGLNATGNNPCNYATCTGEEYLVKQGIDLSPWGLWKNH