Recombinant human Multiple inositol polyphosphate phosphatase 1 (MINPP1)
Artikelnummer:
CSB-YP891977HU
- Bilder (0)
| Artikelname: | Recombinant human Multiple inositol polyphosphate phosphatase 1 (MINPP1) |
| Artikelnummer: | CSB-YP891977HU |
| Hersteller Artikelnummer: | CSB-YP891977HU |
| Alternativnummer: | CSB-YP891977HU-1, CSB-YP891977HU-100, CSB-YP891977HU-20 |
| Hersteller: | Cusabio |
| Kategorie: | Proteine/Peptide |
| Alternative Synonym: | 2,3-bisphosphoglycerate 3-phosphatase (EC:3.1.3.80) ,2,3-BPG phosphataseInositol (1,3,4,5)-tetrakisphosphate 3-phosphatase ,Ins(1,3,4,5)P(4) 3-phosphatase,CSB-PR2024 |
| Molekulargewicht: | 54.1 kDa |
| Tag: | N-terminal 6xHis-tagged |
| UniProt: | Q9UNW1 |
| Puffer: | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Quelle: | Yeast |
| Expression System: | 31-487aa |
| Reinheit: | Greater than 90% as determined by SDS-PAGE. |
| Formulierung: | Liquid or Lyophilized powder |
| Sequenz: | SLLEPRDPVASSLSPYFGTKTRYEDVNPVLLSGPEAPWRDPELLEGTCTPVQLVALIRHGTRYPTVKQIRKLRQLHGLLQARGSRDGGASSTGSRDLGAALADWPLWYADWMDGQLVEKGRQDMRQLALRLASLFPALFSRENYGRLRLITSSKHRCMDSSAAFLQGLWQHYHPGLPPPDVADMEFGPPTVNDKLMRFFDHCEKFLTEVEKNATALYHVEAFKTGPEMQNILKKVAATLQVPVNDLNADLIQVA |
Produktgarantie und fachkundiger Support
