Recombinant Human F-box only protein 3 (FBXO3)

Produktübersicht

• Artikelname: Recombinant Human F-box only protein 3 (FBXO3)
• Artikelnummer: CSB-YP892132HU
• Hersteller Artikelnummer: CSB-YP892132HU
• Alternativnummer: CSB-YP892132HU-1, CSB-YP892132HU-100, CSB-YP892132HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: F Box G - Domain 3, F box only protein 3, F box protein 3, F box protein FBX3, F-box only protein 3, FBA, FBX3, FBX3_HUMAN, FBXO3

Produkteigenschaften

• Molekulargewicht: 56.6 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q9UK99
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 1-471aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MAAMETETAPLTLESLPTDPLLLILSFLDYRDLINCCYVSRRLSQLSSHDPLWRRHCKKYWLISEEEKTQKNQCWKSLFIDTYSDVGRYIDHYAAIKKAWDDLKKYLEPRCPRMVLSLKEGAREEDLDAVEAQIGCKLPDDYRCSYRIHNGQKLVVPGLLGSMALSNHYRSEDLLDVDTAAGGFQQRQGLKYCLPLTFCIHTGLSQYIAVEAAEGRNKNEVFYQCPDQMARNPAAIDMFIIGATFTDWFTSYVK