Recombinant Human F-box/LRR-repeat protein 2 (FBXL2)

Artikelnummer: CSB-YP892134HU
Artikelname: Recombinant Human F-box/LRR-repeat protein 2 (FBXL2)
Artikelnummer: CSB-YP892134HU
Hersteller Artikelnummer: CSB-YP892134HU
Alternativnummer: CSB-YP892134HU-1, CSB-YP892134HU-100, CSB-YP892134HU-20
Hersteller: Cusabio
Kategorie: Proteine/Peptide
Alternative Synonym: F-box and leucine-rich repeat protein 2 F-box protein FBL2/FBL3
Molekulargewicht: 49.1 kDa
Tag: N-terminal 6xHis-tagged
UniProt: Q9UKC9
Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Quelle: Yeast
Expression System: 1-423aa
Reinheit: Greater than 85% as determined by SDS-PAGE.
Formulierung: Liquid or Lyophilized powder
Sequenz: MVFSNNDEGLINKKLPKELLLRIFSFLDIVTLCRCAQISKAWNILALDGSNWQRIDLFNFQTDVEGRVVENISKRCGGFLRKLSLRGCIGVGDSSLKTFAQNCRNIEHLNLNGCTKITDSTCYSLSRFCSKLKHLDLTSCVSITNSSLKGISEGCRNLEYLNLSWCDQITKDGIEALVRGCRGLKALLLRGCTQLEDEALKHIQNYCHELVSLNLQSCSRITDEGVVQICRGCHRLQALCLSGCSNLTDASLTA