Recombinant Human Growth/differentiation factor 2 (GDF2), partial

Produktübersicht

• Artikelname: Recombinant Human Growth/differentiation factor 2 (GDF2), partial
• Artikelnummer: CSB-YP892325HU1
• Hersteller Artikelnummer: CSB-YP892325HU1
• Alternativnummer: CSB-YP892325HU1-1, CSB-YP892325HU1-100, CSB-YP892325HU1-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Bone morphogenetic protein 9 Short name: BMP-9

Produkteigenschaften

• Molekulargewicht: 16.3 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q9UK05
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 300-429aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: HEEDTDGHVAAGSTLARRKRSAGAGSHCQKTSLRVNFEDIGWDSWIIAPKEYEAYECKGGCFFPLADDVTPTKHAIVQTLVHLKFPTKVGKACCVPTKLSPISVLYKDDMGVPTLKYHYEGMSVAECGCR