Recombinant Human Protein-arginine deiminase type-2 (PADI2) Preis auf Anfrage

Produktübersicht

• Artikelname: Recombinant Human Protein-arginine deiminase type-2 (PADI2) Preis auf Anfrage
• Artikelnummer: CSB-YP896493HU
• Hersteller Artikelnummer: CSB-YP896493HU
• Alternativnummer: CSB-YP896493HU-1,CSB-YP896493HU-100,CSB-YP896493HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: PAD-H19Peptidylarginine deiminase IIProtein-arginine deiminase type II

Produkteigenschaften

• Molekulargewicht: 77.6 kDa
• Tag: N-terminal 6xHis-tagged
• UniProt: Q9Y2J8
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 1-665aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MLRERTVRLQYGSRVEAVYVLGTYLWTDVYSAAPAGAQTFSLKHSEHVWVEVVRDGEAEEVATNGKQRWLLSPSTTLRVTMSQASTEASSDKVTVNYYDEEGSIPIDQAGLFLTAIEISLDVDADRDGVVEKNNPKKASWTWGPEGQGAILLVNCDRETPWLPKEDCRDEKVYSKEDLKDMSQMILRTKGPDRLPAGYEIVLYISMSDSDKVGVFYVENPFFGQRYIHILGRRKLYHVVKYTGGSAELLFFVEG