Recombinant Human Sialidase-2 (NEU2) Preis auf Anfrage

Produktübersicht

• Artikelname: Recombinant Human Sialidase-2 (NEU2) Preis auf Anfrage
• Artikelnummer: CSB-YP896716HU
• Hersteller Artikelnummer: CSB-YP896716HU
• Alternativnummer: CSB-YP896716HU-1, CSB-YP896716HU-100, CSB-YP896716HU-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Cytosolic sialidase,N-acetyl-alpha-neuraminidase 2

Produkteigenschaften

• Molekulargewicht: 43.8 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: Q9Y3R4
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 1-380aa
• Reinheit: Greater than 95% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: MASLPVLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAPTHQVQWQAQEVVAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRLCQVTSTDHGRTWSSPRDLTDAAIGPAYREWSTFAVGPGHCLQLHDRARSLVVPAYAYRKLHPIQRPIPSAFCFLSHDHGRTWARGHFVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLD