Recombinant Human Atrial natriuretic peptide-converting enzyme (CORIN), partial Preis auf Anfrage

Produktübersicht

• Artikelname: Recombinant Human Atrial natriuretic peptide-converting enzyme (CORIN), partial Preis auf Anfrage
• Artikelnummer: CSB-YP896913HU1
• Hersteller Artikelnummer: CSB-YP896913HU1
• Alternativnummer: CSB-YP896913HU1-1, CSB-YP896913HU1-100, CSB-YP896913HU1-20
• Hersteller: Cusabio
• Kategorie: Proteine/Peptide
• Alternative Synonym: Corin,Heart-specific serine proteinase ATC2,Pro-ANP-converting enzyme,Transmembrane protease serine 10

Produkteigenschaften

• Molekulargewicht: 43.6 kDa
• Tag: C-terminal 6xHis-tagged
• UniProt: Q9Y5Q5
• Puffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Quelle: Yeast
• Expression System: 428-801aa
• Reinheit: Greater than 90% as determined by SDS-PAGE.
• Formulierung: Liquid or Lyophilized powder
• Sequenz: CLYNPCLDSCGGSSLCDPNNSLNNCSQCEPITLELCMNLPYNSTSYPNYFGHRTQKEASISWESSLFPALVQTNCYKYLMFFSCTILVPKCDVNTGEHIPPCRALCEHSKERCESVLGIVGLQWPEDTDCSQFPEENSDNQTCLMPDEYVEECSPSHFKCRSGQCVLASRRCDGQADCDDDSDEENCGCKERDLWECPSNKQCLKHTVICDGFPDCPDYMDEKNCSFCQDDELECANHACVSRDLWCDGEADCS