4-1BBL, E. coli

Artikelnummer: DNA-CYT-026729
Artikelname: 4-1BBL, E. coli
Artikelnummer: DNA-CYT-026729
Hersteller Artikelnummer: DNA-CYT-026729
Alternativnummer: DNA-CYT-026729
Hersteller: dianova
Wirt: E. coli
Kategorie: Sonstiges
Spezies Reaktivität: Human
Alternative Synonym: TNFSF9, CD137L, 4-1BB-L
4-1BBL, a member of the TNF superfamily, is expressed in B cells, dendritic cells, activated T cells and macrophages. 4-1BBL binds to its receptor 4-1BB, and provides a co-stimulatory signal for T cell activation and expansion. The human 4-1BBL gene code
Molekulargewicht: 19.5 kDa
NCBI: 8744
UniProt: P41273
Reinheit: > 97% by SDS-PAGE & HPLC analyses
Sequenz: MREGPELSPDDPAGLLDLRQGMFAQLVAQNVLLIDGPLSWYSDPGLAGVSLTGGLSYKEDTKELVVAKAGVYYVFFQLELRRVVAGEGSGSVSLALHLQPLRSAAGAAALALTVDLPPASSEARNSAFGFQGRLLHLSAGQRLGVHLHTEARARHAWQLTQGATVLGLFRVTPEIPAGLPSPRSE
Application Verdünnung: Determined by the dose-dependent stimulation of IL-8 production by human PBMC. The expected ED50 for this effect is 5-10 ng/ml. NOTE: Results may vary with different PBMC donors.