EGF, E. coli

Artikelnummer: DNA-CYT-026737
Artikelname: EGF, E. coli
Artikelnummer: DNA-CYT-026737
Hersteller Artikelnummer: DNA-CYT-026737
Alternativnummer: DNA-CYT-026737
Hersteller: dianova
Wirt: E. coli
Kategorie: Sonstiges
Spezies Reaktivität: Human, Mouse
Alternative Synonym: Epidermal growth factor, EGF, URG, HOMG4, Urogastrone
Epidermal growth factor (EGF) is the founding member of the EGF family that also includes TGFalpha, amphiregulin (AR), betacellulin (BTC), epiregulin (EPR), heparin-binding EGF-like growth factor (HBEGF), epigen, and the neuregulins (NRG) 1 through 6. Member
Molekulargewicht: 6.35 kDa
NCBI: 1950
UniProt: P01133
Puffer: PBS
Reinheit: > 95% by SDS-PAGE
Sequenz: MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR
Application Verdünnung: The biological activity was determined by the ability to induce EGF receptor phosphorylation in the A431 tumor cell line [Soler et al, J Chromatography B, 788, 2003] and the induction of proliferation in NHDF cells (Normal Human Dermal Fibroblasts).