Recombinant Human IL-12 p35 protein(N-His)(active)

Produktübersicht

• Artikelname: Recombinant Human IL-12 p35 protein(N-His)(active)
• Artikelnummer: ELA-PKSH034103
• Hersteller Artikelnummer: PKSH034103
• Alternativnummer: ELA-PKSH034103-100, ELA-PKSH034103-20
• Hersteller: Elabscience
• Kategorie: Proteine/Peptide
• Applikation: Cell Culture
• Spezies Reaktivität: Human
• Alternative Synonym: Interleukin-12 subunit alpha,IL-12 subunit p35,IL-12A,Cytotoxic Lymphocyte Maturation Factor 35 kDa

Produkteigenschaften

• Tag: N-His
• NCBI: 29459
• UniProt: P29459
• Expression System: E.coli
• Reinheit: > 95 % as determined by reducing SDS-PAGE.
• Formulierung: Lyophilized from sterile PBS, pH 8.0Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual.
• Sequenz: MCPARSLLLVATLVLLDHLSLARNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS
• Target-Kategorie: IL-12 p35