Recombinant Human IL-16 (129 a.a.) protein(N-His)

Produktübersicht

• Artikelname: Recombinant Human IL-16 (129 a.a.) protein(N-His)
• Artikelnummer: ELA-PKSH034104
• Hersteller Artikelnummer: PKSH034104
• Alternativnummer: ELA-PKSH034104-100, ELA-PKSH034104-20
• Hersteller: Elabscience
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Human
• Alternative Synonym: LCF (Lymphocyte Chemoattractant Factor)

Produkteigenschaften

• Tag: N-His
• NCBI: 14005
• UniProt: Q14005
• Expression System: E.coli
• Reinheit: > 95 % as determined by reducing SDS-PAGE.
• Formulierung: Lyophilized from sterile PBS, pH 8.0Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual.
• Sequenz: MESHSRAGKSRKSAKFRSISRSLMLCNAKTSDDGSSPDEKYPDPFEISLAQGKEGIFHSSVQLADTSEAGPSSVPDLALASEAAQLQAAGNDRGKTCRRIFFMKESSTASSREKPGKLEAQSSNFLFPKACHQRARSNSTSVNPYCTREIDFPMTKKSAAPTDRQPYSLCSNRKSLSQQLDCPAGKAAGTSRPTRSLSTAQLVQPSGGLQASVISNIVLMKGQAKGLGFSIVGGKDSIYGPIGIYVKTIFAGGA
• Target-Kategorie: IL-16