Recombinant Human IL-21 protein(N-His)(active)

Artikelnummer: ELA-PKSH034107
Artikelname: Recombinant Human IL-21 protein(N-His)(active)
Artikelnummer: ELA-PKSH034107
Hersteller Artikelnummer: PKSH034107
Alternativnummer: ELA-PKSH034107-100, ELA-PKSH034107-20
Hersteller: Elabscience
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Human
Alternative Synonym: Za11
Tag: C-His
NCBI: 9
UniProt: Q9HBE4
Expression System: E.coli
Reinheit: > 95 % as determined by reducing SDS-PAGE.
Formulierung: Lyophilized from sterile PBS, pH 8.0Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual.
Sequenz: MQDRHMIRMRQLIDIVDQLKNYVNDLVPEFLPAPEDVETNCEWSAFSCFQKAQLKSANTGNNERIINVSIKKLKRKPPSTNAGRRQKHRLTCPSCDSYEKKPPKEFLERFKSLLQKMIHQHLSSRTHGSEDS
Target-Kategorie: IL-21