Recombinant Human IL-28B protein(N-His)(active)

Produktübersicht

• Artikelname: Recombinant Human IL-28B protein(N-His)(active)
• Artikelnummer: ELA-PKSH034113
• Hersteller Artikelnummer: PKSH034113
• Alternativnummer: ELA-PKSH034113-100, ELA-PKSH034113-20
• Hersteller: Elabscience
• Kategorie: Proteine/Peptide
• Applikation: Cell Culture
• Spezies Reaktivität: Human
• Alternative Synonym: interferon lambda 3,IFNL3,IFN-lambda-3,IFN-lambda-4,IL-28C,IL28C

Produkteigenschaften

• Tag: N-His
• NCBI: 8
• UniProt: Q8IZI9
• Expression System: E.coli
• Reinheit: > 95 % as determined by reducing SDS-PAGE.
• Formulierung: Lyophilized from sterile PBS, pH 8.0Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual.
• Sequenz: MTGDCMPVLVLMAAVLTVTGAVPVARLRGALPDARGCHIAQFKSLSPQELQAFKRAKDALEESLLLKDCKCRSRLFPRTWDLRQLQVRERPVALEAELALTLKVLEATADTDPALGDVLDQPLHTLHHILSQLRACIQPQPTAGPRTRGRLHHWLHRLQEAPKKESPGCLEASVTFNLFRLLTRDLNCVASGDLCV
• Target-Kategorie: IL-28B