Recombinant Human LIGHT, Human protein(N-His)(active)
Artikelnummer:
ELA-PKSH034125
- Bilder (0)
| Artikelname: | Recombinant Human LIGHT, Human protein(N-His)(active) |
| Artikelnummer: | ELA-PKSH034125 |
| Hersteller Artikelnummer: | PKSH034125 |
| Alternativnummer: | ELA-PKSH034125-100, ELA-PKSH034125-20 |
| Hersteller: | Elabscience |
| Kategorie: | Proteine/Peptide |
| Applikation: | Cell Culture |
| Spezies Reaktivität: | Human |
| Alternative Synonym: | TNFSF14,HVEM-L,CD258 |
| Tag: | N-His |
| NCBI: | 43557 |
| UniProt: | O43557 |
| Expression System: | E.coli |
| Reinheit: | > 98 % as determined by reducing SDS-PAGE. |
| Formulierung: | Lyophilized from a solution containing 0.1% sarkosyl in 1X PBS, pH8.0.Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequenz: | MEESVVRPSVFVVDGQTDIPFTRLGRSHRRQSCSVARVGLGLLLLLMGAGLAVQGWFLLQLHWRLGEMVTRLPDGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGALVVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSSSRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV |
| Target-Kategorie: | LIGHT, Human |
Produktgarantie und fachkundiger Support
