Recombinant Human VEGF165 protein(N-His)(active)
Artikelnummer:
ELA-PKSH034126
- Bilder (0)
| Artikelname: | Recombinant Human VEGF165 protein(N-His)(active) |
| Artikelnummer: | ELA-PKSH034126 |
| Hersteller Artikelnummer: | PKSH034126 |
| Alternativnummer: | ELA-PKSH034126-100, ELA-PKSH034126-20 |
| Hersteller: | Elabscience |
| Kategorie: | Proteine/Peptide |
| Applikation: | Cell Culture |
| Spezies Reaktivität: | Human |
| Alternative Synonym: | VPF,Folliculostellate cell-derived growth factor,Glioma-derived endothelial cell mitogen |
| Tag: | N-His |
| NCBI: | 15692 |
| UniProt: | P15692 |
| Expression System: | E.coli |
| Reinheit: | > 98 % as determined by reducing SDS-PAGE. |
| Formulierung: | Lyophilized from sterile PBS, pH 8.0Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequenz: | MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKKSVRGKGKGQKRKRKKSRYKSWSVYVGARCCLMPWSLPGPHPCGPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR |
| Target-Kategorie: | VEGF165 |
Produktgarantie und fachkundiger Support
