Recombinant Human BMP-10 protein(N-His)(active)

Produktübersicht

• Artikelname: Recombinant Human BMP-10 protein(N-His)(active)
• Artikelnummer: ELA-PKSH034137
• Hersteller Artikelnummer: PKSH034137
• Alternativnummer: ELA-PKSH034137-100, ELA-PKSH034137-20
• Hersteller: Elabscience
• Kategorie: Proteine/Peptide
• Applikation: Cell Culture
• Spezies Reaktivität: Human
• Alternative Synonym: BMP-10

Produkteigenschaften

• Tag: N-His
• NCBI: 95393
• UniProt: O95393
• Expression System: E.coli
• Reinheit: > 98 % as determined by reducing SDS-PAGE.
• Formulierung: Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5.Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual.
• Sequenz: MGSLVLTLCALFCLAAYLVSGSPIMNLEQSPLEEDMSLFGDVFSEQDGVDFNTLLQSMKDEFLKTLNLSDIPTQDSAKVDPPEYMLELYNKFATDRTSMPSANIIRSFKNEDLFSQPVSFNGLRKYPLLFNVSIPHHEEVIMAELRLYTLVQRDRMIYDGVDRKITIFEVLESKGDNEGERNMLVLVSGEIYGTNSEWETFDVTDAIRRWQKSGSSTHQLEVHIESKHDEAEDASSGRLEIDTSAQNKHNPLLI
• Target-Kategorie: BMP-10