Recombinant Human BMP-16 protein(N-His)(active)

Artikelnummer: ELA-PKSH034141
Artikelname: Recombinant Human BMP-16 protein(N-His)(active)
Artikelnummer: ELA-PKSH034141
Hersteller Artikelnummer: PKSH034141
Alternativnummer: ELA-PKSH034141-100, ELA-PKSH034141-20
Hersteller: Elabscience
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Human
Alternative Synonym: Nodal
Tag: N-His
NCBI: 96
UniProt: Q96S42
Expression System: E.coli
Reinheit: > 98 % as determined by reducing SDS-PAGE.
Formulierung: Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5.Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual.
Sequenz: MHAHCLPFLLHAWWALLQAGAATVATALLRTRGQPSSPSPLAYMLSLYRDPLPRADIIRSLQAEDVAVDGQNWTFAFDFSFLSQQEDLAWAELRLQLSSPVDLPTEGSLAIEIFHQPKPDTEQASDSCLERFQMDLFTVTLSQVTFSLGSMVLEVTRPLSKWLKHPGALEKQMSRVAGECWPRPPTPPATNVLLMLYSNLSQEQRQLGGSTLLWEAESSWRAQEGQLSWEWGKRHRRHHLPDRSQLCRKVKFQV
Target-Kategorie: BMP-16