Recombinant Human HMGB2 protein(N-His)

Artikelnummer: ELA-PKSH034145
Artikelname: Recombinant Human HMGB2 protein(N-His)
Artikelnummer: ELA-PKSH034145
Hersteller Artikelnummer: PKSH034145
Alternativnummer: ELA-PKSH034145-100, ELA-PKSH034145-20
Hersteller: Elabscience
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: HMG2
Tag: N-His
NCBI: 26583
UniProt: P26583
Expression System: E.coli
Reinheit: > 98 % as determined by reducing SDS-PAGE.
Formulierung: Lyophilized from sterile PBS, pH 8.0Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual.
Sequenz: MGKGDPNKPRGKMSSYAFFVQTCREEHKKKHPDSSVNFAEFSKKCSERWKTMSAKEKSKFEDMAKSDKARYDREMKNYVPPKGDKKGKKKDPNAPKRPPSAFFLFCSEHRPKIKSEHPGLSIGDTAKKLGEMWSEQSAKDKQPYEQKAAKLKEKYEKDIAAYRAKGKSEAGKKGPGRPTGSKKKNEPEDEEEEEEEEDEDEEEEDEDEE
Target-Kategorie: HMGB2