Recombinant Human CXCL12 (24-88) protein(N-His)(active)
Artikelnummer:
ELA-PKSH034169
- Bilder (0)
| Artikelname: | Recombinant Human CXCL12 (24-88) protein(N-His)(active) |
| Artikelnummer: | ELA-PKSH034169 |
| Hersteller Artikelnummer: | PKSH034169 |
| Alternativnummer: | ELA-PKSH034169-100, ELA-PKSH034169-20 |
| Hersteller: | Elabscience |
| Kategorie: | Proteine/Peptide |
| Applikation: | Cell Culture |
| Spezies Reaktivität: | Human |
| Alternative Synonym: | IRH,PBSF,SCYB12,SDF1,TLSF,TPAR1 |
| Tag: | N-His |
| NCBI: | 48061 |
| UniProt: | P48061 |
| Expression System: | E.coli |
| Reinheit: | > 98 % as determined by reducing SDS-PAGE. |
| Formulierung: | Lyophilized from a solution containing 20 mM sodium citrate, 0.1 MNaCl, pH 4.5.Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequenz: | MNAKVVVVLVLVLTALCLSDGKPVSLSYRCPCRFFESHVARANVKHLKILNTPNCALQIVARLKNNNRQVCIDPKLKWIQEYLEKALNKRFKM |
| Target-Kategorie: | CXCL12 |
Produktgarantie und fachkundiger Support
