Recombinant Human CDNF protein(N-His)
Artikelnummer:
ELA-PKSH034175
- Bilder (0)
| Artikelname: | Recombinant Human CDNF protein(N-His) |
| Artikelnummer: | ELA-PKSH034175 |
| Hersteller Artikelnummer: | PKSH034175 |
| Alternativnummer: | ELA-PKSH034175-100, ELA-PKSH034175-20 |
| Hersteller: | Elabscience |
| Kategorie: | Proteine/Peptide |
| Spezies Reaktivität: | Human |
| Alternative Synonym: | ARMETL1 |
| Tag: | N-His |
| NCBI: | 49 |
| UniProt: | Q49AH0 |
| Expression System: | E.coli |
| Reinheit: | > 98 % as determined by reducing SDS-PAGE. |
| Formulierung: | Lyophilized from sterile PBS, pH 8.0Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequenz: | MWCASPVAVVAFCAGLLVSHPVLTQGQEAGGRPGADCEVCKEFLNRFYKSLIDRGVNFSLDTIEKELISFCLDTKGKENRLCYYLGATKDAATKILSEVTRPMSVHMPAMKICEKLKKLDSQICELKYEKTLDLASVDLRKMRVAELKQILHSWGEECRACAEKTDYVNLIQELAPKYAATHPKTEL |
| Target-Kategorie: | CDNF |
Produktgarantie und fachkundiger Support
