Recombinant Human Pleiotrophin protein(N-His)

Artikelnummer: ELA-PKSH034178
Artikelname: Recombinant Human Pleiotrophin protein(N-His)
Artikelnummer: ELA-PKSH034178
Hersteller Artikelnummer: PKSH034178
Alternativnummer: ELA-PKSH034178-100, ELA-PKSH034178-20
Hersteller: Elabscience
Kategorie: Proteine/Peptide
Spezies Reaktivität: Human
Alternative Synonym: PTN,Heparin Affin Regulatory Protein (HARP),Heparin-Binding Growth Factor-8 (HBGF-8),Osteoblast-Specific Factor 1 (OSF-1)
Tag: N-His
NCBI: 21246
UniProt: P21246
Expression System: E.coli
Reinheit: > 98 % as determined by reducing SDS-PAGE.
Formulierung: Lyophilized from sterile PBS, pH 7.4Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual.
Sequenz: MQAQQYQQQRRKFAAAFLAFIFILAAVDTAEAGKKEKPEKKVKKSDCGEWQWSVCVPTSGDCGLGTREGTRTGAECKQTMKTQRCKIPCNWKKQFGAECKYQFQAWGECDLNTALKTRTGSLKRALHNAECQKTVTISKPCGKLTKPKPQAESKKKKKEGKKQEKMLD
Target-Kategorie: Pleiotrophin