Recombinant Human GIF protein(N-His)
Artikelnummer:
ELA-PKSH034179
- Bilder (0)
| Artikelname: | Recombinant Human GIF protein(N-His) |
| Artikelnummer: | ELA-PKSH034179 |
| Hersteller Artikelnummer: | PKSH034179 |
| Alternativnummer: | ELA-PKSH034179-100, ELA-PKSH034179-20 |
| Hersteller: | Elabscience |
| Kategorie: | Proteine/Peptide |
| Spezies Reaktivität: | Human |
| Alternative Synonym: | CBLIF,IF,IFMH,INF,TCN3 |
| Tag: | N-His |
| NCBI: | 27352 |
| UniProt: | P27352 |
| Expression System: | E.coli |
| Reinheit: | > 98 % as determined by reducing SDS-PAGE. |
| Formulierung: | Lyophilized from sterile PBS, pH 8.0Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequenz: | MAWFALYLLSLLWATAGTSTQTQSSCSVPSAQEPLVNGIQVLMENSVTSSAYPNPSILIAMNLAGAYNLKAQKLLTYQLMSSDNNDLTIGQLGLTIMALTSSCRDPGDKVSILQRQMENWAPSSPNAEASAFYGPSLAILALCQKNSEATLPIAVRFAKTLLANSSPFNVDTGAMATLALTCMYNKIPVGSEEGYRSLFGQVLKDIVEKISMKIKDNGIIGDIYSTGLAMQALSVTPEPSKKEWNCKKTTDMIL |
| Target-Kategorie: | GIF |
Produktgarantie und fachkundiger Support
