Recombinant Human CD326 protein(N-His)(active)
Artikelnummer:
ELA-PKSH034180
- Bilder (0)
| Artikelname: | Recombinant Human CD326 protein(N-His)(active) |
| Artikelnummer: | ELA-PKSH034180 |
| Hersteller Artikelnummer: | PKSH034180 |
| Alternativnummer: | ELA-PKSH034180-100, ELA-PKSH034180-20 |
| Hersteller: | Elabscience |
| Kategorie: | Proteine/Peptide |
| Applikation: | ELISA |
| Spezies Reaktivität: | Human |
| Alternative Synonym: | EPCAM,DIAR5,EGP-2,EGP314,EGP40,ESA,HNPCC8,KS1/4,KSA,M4S1,MIC18,MK-1,TACSTD1,TROP1 |
| Tag: | N-His |
| NCBI: | 16422 |
| UniProt: | P16422 |
| Expression System: | E.coli |
| Reinheit: | > 95 % as determined by reducing SDS-PAGE. |
| Formulierung: | Lyophilized from sterile PBS, pH 8.0Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequenz: | MAPPQVLAFGLLLAAATATFAAAQEECVCENYKLAVNCFVNNNRQCQCTSVGAQNTVICSKLAAKCLVMKAEMNGSKLGRRAKPEGALQNNDGLYDPDCDESGLFKAKQCNGTSMCWCVNTAGVRRTDKDTEITCSERVRTYWIIIELKHKAREKPYDSKSLRTALQKEITTRYQLDPKFITSILYENNVITIDLVQNSSQKTQNDVDIADVAYYFEKDVKGESLFHSKKMDLTVNGEQLDLDPGQTLIYYVDE |
| Target-Kategorie: | CD326 |
Produktgarantie und fachkundiger Support
