Recombinant Human Galectin-10 protein(N-His)
Artikelnummer:
ELA-PKSH034186
- Bilder (0)
| Artikelname: | Recombinant Human Galectin-10 protein(N-His) |
| Artikelnummer: | ELA-PKSH034186 |
| Hersteller Artikelnummer: | PKSH034186 |
| Alternativnummer: | ELA-PKSH034186-100, ELA-PKSH034186-20 |
| Hersteller: | Elabscience |
| Kategorie: | Proteine/Peptide |
| Spezies Reaktivität: | Human |
| Alternative Synonym: | GAL10,Gal-10,LGALS10,LGALS10A,LPPL_HUMAN |
| Tag: | N-His |
| NCBI: | 05315 |
| UniProt: | Q05315 |
| Expression System: | E.coli |
| Reinheit: | > 98 % as determined by reducing SDS-PAGE. |
| Formulierung: | Lyophilized from sterile PBS, pH 7.4Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequenz: | MSLLPVPYTEAASLSTGSTVTIKGRPLACFLNEPYLQVDFHTEMKEESDIVFHFQVCFGRRVVMNSREYGAWKQQVESKNMPFQDGQEFELSISVLPDKYQVMVNGQSSYTFDHRIKPEAVKMVQVWRDISLTKFNVSYLKR |
| Target-Kategorie: | Galectin-10 |
Produktgarantie und fachkundiger Support
