Recombinant Human Noggin protein(C-His)(active)
Artikelnummer:
ELA-PKSH034199
- Bilder (0)
| Artikelname: | Recombinant Human Noggin protein(C-His)(active) |
| Artikelnummer: | ELA-PKSH034199 |
| Hersteller Artikelnummer: | PKSH034199 |
| Alternativnummer: | ELA-PKSH034199-100, ELA-PKSH034199-20 |
| Hersteller: | Elabscience |
| Kategorie: | Proteine/Peptide |
| Applikation: | Cell Culture |
| Spezies Reaktivität: | Human |
| Alternative Synonym: | NOG,Noggin,SYM1,symphalangism 1 (proximal),synostoses (multiple) syndrome 1,SYNS1,SYNS1A |
| Tag: | C-His |
| NCBI: | 13253 |
| UniProt: | Q13253 |
| Expression System: | E.coli |
| Reinheit: | > 98 % as determined by reducing SDS-PAGE. |
| Formulierung: | Lyophilized from a solution containing 0.1% sarkosyl in 1X PBS, pH8.0.Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequenz: | MERCPSLGVTLYALVVVLGLRATPAGGQHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGAAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC |
| Target-Kategorie: | Noggin |
Produktgarantie und fachkundiger Support
