Recombinant Mouse IL-3 protein(N-His)(active)

Produktübersicht

• Artikelname: Recombinant Mouse IL-3 protein(N-His)(active)
• Artikelnummer: ELA-PKSM041460
• Hersteller Artikelnummer: PKSM041460
• Alternativnummer: ELA-PKSM041460-100, ELA-PKSM041460-20
• Hersteller: Elabscience
• Kategorie: Proteine/Peptide
• Applikation: Cell Culture
• Spezies Reaktivität: Mouse
• Alternative Synonym: Interleukin-3,IL-3,Hematopoietic Growth Factor,Mast Cell Growth Factor,MCGF,Multipotential Colony-Stimulating Factor,P-Cell-Stimulating Factor,IL3

Produkteigenschaften

• Tag: N-His
• NCBI: 01586
• UniProt: P01586
• Expression System: E.coli
• Reinheit: > 98 % as determined by reducing SDS-PAGE.
• Formulierung: Lyophilized from sterile PBS, pH 7.4Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual.
• Sequenz: MVLASSTTSIHTMLLLLLMLFHLGLQASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC
• Target-Kategorie: IL-3