Recombinant Mouse IL-12 p40 protein(N-His)(active)

Produktübersicht

• Artikelname: Recombinant Mouse IL-12 p40 protein(N-His)(active)
• Artikelnummer: ELA-PKSM041465
• Hersteller Artikelnummer: PKSM041465
• Alternativnummer: ELA-PKSM041465-100, ELA-PKSM041465-20
• Hersteller: Elabscience
• Kategorie: Proteine/Peptide
• Applikation: Cell Culture
• Spezies Reaktivität: Mouse
• Alternative Synonym: Interleukin-12 subunit beta,IL-12 subunit p40,IL-12B,Cytotoxic Lymphocyte Maturation Factor 40 kDa subunit (CLMF p40),NK cell Stimulating Factor Chain 2

Produkteigenschaften

• Tag: N-His
• NCBI: 43432
• UniProt: P43432
• Expression System: E.coli
• Reinheit: > 98 % as determined by reducing SDS-PAGE.
• Formulierung: Lyophilized from sterile PBS, pH 7.4Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual.
• Sequenz: MCPQKLTISWFAIVLLVSPLMAMWELEKDVYVVEVDWTPDAPGETVNLTCDTPEEDDITWTSDQRHGVIGSGKTLTITVKEFLDAGQYTCHKGGETLSHSHLLLHKKENGIWSTEILKNFKNKTFLKCEAPNYSGRFTCSWLVQRNMDLKFNIKSSSSSPDSRAVTCGMASLSAEKVTLDQRDYEKYSVSCQEDVTCPTAEETLPIELALEARQQNKYENYSTSFFIRDIIKPDPPKNLQMKPLKNSQVEVSWE
• Target-Kategorie: IL-12 p40