Recombinant Mouse IL-17F protein(N-His)(active)
Artikelnummer:
ELA-PKSM041467
- Bilder (0)
| Artikelname: | Recombinant Mouse IL-17F protein(N-His)(active) |
| Artikelnummer: | ELA-PKSM041467 |
| Hersteller Artikelnummer: | PKSM041467 |
| Alternativnummer: | ELA-PKSM041467-100, ELA-PKSM041467-20 |
| Hersteller: | Elabscience |
| Kategorie: | Proteine/Peptide |
| Applikation: | Cell Culture |
| Spezies Reaktivität: | Mouse |
| Alternative Synonym: | Interleukin-17F,IL-17F,Cytokine ML-1,Interleukin-24,IL-24,IL17F,IL24 |
| Tag: | N-His |
| NCBI: | 7 |
| UniProt: | Q7TNI7 |
| Expression System: | E.coli |
| Reinheit: | > 98 % as determined by reducing SDS-PAGE. |
| Formulierung: | Lyophilized from a solution containing 20 mM sodium citrate, pH 4.5.Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequenz: | MKCTRETAMVKSLLLLMLGLAILREVAARKNPKAGVPALQKAGNCPPLEDNTVRVDIRIFNQNQGISVPREFQNRSSSPWDYNITRDPHRFPSEIAEAQCRHSGCINAQGQEDSTMNSVAIQQEILVLRREPQGCSNSFRLEKMLLKVGCTCVKPIVHQAA |
| Target-Kategorie: | IL-17F |
Produktgarantie und fachkundiger Support
