Recombinant Mouse TNF beta protein(N-His)(active)

Artikelnummer: ELA-PKSM041484
Artikelname: Recombinant Mouse TNF beta protein(N-His)(active)
Artikelnummer: ELA-PKSM041484
Hersteller Artikelnummer: PKSM041484
Alternativnummer: ELA-PKSM041484-100, ELA-PKSM041484-20
Hersteller: Elabscience
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Mouse
Alternative Synonym: IFN-lambda3,IFL,IFL-1,INF-alpha,INF-l,INF-lambda
Tag: N-His
NCBI: 09225
UniProt: P09225
Expression System: E.coli
Reinheit: > 98 % as determined by reducing SDS-PAGE.
Formulierung: Lyophilized from sterile PBS, pH 8.0Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual.
Sequenz: MTLLGRLHLLRVLGTPPVFLLGLLLALPLGAQGLSGVRFSAARTAHPLPQKHLTHGILKPAAHLVGYPSKQNSLLWRASTDRAFLRHGFSLSNNSLLIPTSGLYFVYSQVVFSGESCSPRAIPTPIYLAHEVQLFSSQYPFHVPLLSAQKSVYPGLQGPWVRSMYQGAVFLLSKGDQLSTHTDGISHLHFSPSSVFFGAFAL
Target-Kategorie: TNF beta