Recombinant Mouse BAFF protein(N-His)(active)

Artikelnummer: ELA-PKSM041485
Artikelname: Recombinant Mouse BAFF protein(N-His)(active)
Artikelnummer: ELA-PKSM041485
Hersteller Artikelnummer: PKSM041485
Alternativnummer: ELA-PKSM041485-100, ELA-PKSM041485-20
Hersteller: Elabscience
Kategorie: Proteine/Peptide
Applikation: Cell Culture
Spezies Reaktivität: Mouse
Alternative Synonym: p40 cytokine,T-cell growth factor p40
Tag: N-His
NCBI: 9
UniProt: Q9WU72
Expression System: E.coli
Reinheit: > 98 % as determined by reducing SDS-PAGE.
Formulierung: Lyophilized from sterile PBS, pH 7.4Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual.
Sequenz: MDESAKTLPPPCLCFCSEKGEDMKVGYDPITPQKEEGAWFGICRDGRLLAATLLLALLSSSFTAMSLYQLAALQADLMNLRMELQSYRGSATPAAAGAPELTAGVKLLTPAAPRPHNSSRGHRNRRAFQGPEETEQDVDLSAPPAPCLPGCRHSQHDDNGMNLRNIIQDCLQLIADSDTPTIRKGTYTFVPWLLSFKRGNALEEKENKIVVRQTGYFFIYSQVLYTDPIFAMGHVIQRKKVHVFGDELSLVTLF
Target-Kategorie: BAFF