Recombinant Mouse BMP-4 protein(N-His)(active)
Artikelnummer:
ELA-PKSM041491
- Bilder (0)
| Artikelname: | Recombinant Mouse BMP-4 protein(N-His)(active) |
| Artikelnummer: | ELA-PKSM041491 |
| Hersteller Artikelnummer: | PKSM041491 |
| Alternativnummer: | ELA-PKSM041491-100, ELA-PKSM041491-20 |
| Hersteller: | Elabscience |
| Kategorie: | Proteine/Peptide |
| Applikation: | Cell Culture |
| Spezies Reaktivität: | Mouse |
| Alternative Synonym: | interleukin 1 family,member 9,IL-1F9,IL-1epsilon (epsilon) and IL-1H1 |
| Tag: | N-His |
| NCBI: | 21275 |
| UniProt: | P21275 |
| Expression System: | E.coli |
| Reinheit: | > 98 % as determined by reducing SDS-PAGE. |
| Formulierung: | Lyophilized from a solution containing 20 mM sodium carbonate, pH 4.5.Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequenz: | MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEEQSQGTGLEYPERPASRANTVRSFHHEEHLENIPGTSESSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWEQGFHRINIYEVMKPPAEMVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQHVR |
| Target-Kategorie: | BMP-4 |
Produktgarantie und fachkundiger Support
