Recombinant Mouse IFN beta 1a protein(N-His)(active)
Artikelnummer:
ELA-PKSM041493
- Bilder (0)
| Artikelname: | Recombinant Mouse IFN beta 1a protein(N-His)(active) |
| Artikelnummer: | ELA-PKSM041493 |
| Hersteller Artikelnummer: | PKSM041493 |
| Alternativnummer: | ELA-PKSM041493-100, ELA-PKSM041493-20 |
| Hersteller: | Elabscience |
| Kategorie: | Proteine/Peptide |
| Applikation: | Cell Culture |
| Spezies Reaktivität: | Mouse |
| Alternative Synonym: | interleukin 1 family,member 10,IL1F10 |
| Tag: | N-His |
| NCBI: | 01575 |
| UniProt: | P01575 |
| Expression System: | E.coli |
| Reinheit: | > 98 % as determined by reducing SDS-PAGE. |
| Formulierung: | Lyophilized from sterile PBS, pH 7.4Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequenz: | MNNRWILHAAFLLCFSTTALSINYKQLQLQERTNIRKCQELLEQLNGKINLTYRADFKIPMEMTEKMQKSYTAFAIQEMLQNVFLVFRNNFSSTGWNETIVVRLLDELHQQTVFLKTVLEEKQEERLTWEMSSTALHLKSYYWRVQRYLKLMKYNSYAWMVVRAEIFRNFLIIRRLTRNFQN |
| Target-Kategorie: | IFN beta 1a |
Produktgarantie und fachkundiger Support
