Recombinant Mouse Flt-3 Ligand protein(N-His)(active)

Produktübersicht

• Artikelname: Recombinant Mouse Flt-3 Ligand protein(N-His)(active)
• Artikelnummer: ELA-PKSM041496
• Hersteller Artikelnummer: PKSM041496
• Alternativnummer: ELA-PKSM041496-100, ELA-PKSM041496-20
• Hersteller: Elabscience
• Kategorie: Proteine/Peptide
• Applikation: Cell Culture
• Spezies Reaktivität: Mouse
• Alternative Synonym: soluble Fas Ligand (sFasL),TNFSF6,CD95L,Apo I Ligand,APTL,APT1LG1,CD178,Fas-Lg,Tnfs,Tnlg1a,gld

Produkteigenschaften

• Tag: N-His
• NCBI: 49772
• UniProt: P49772
• Expression System: E.coli
• Reinheit: > 98 % as determined by reducing SDS-PAGE.
• Formulierung: Lyophilized from sterile PBS, pH 7.4Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual.
• Sequenz: MTVLAPAWSPNSSLLLLLLLLSPCLRGTPDCYFSHSPISSNFKVKFRELTDHLLKDYPVTVAVNLQDEKHCKALWSLFLAQRWIEQLKTVAGSKMQTLLEDVNTEIHFVTSCTFQPLPECLRFVQTNISHLLKDTCTQLLALKPCIGKACQNFSRCLEVQCQPDSSTLLPPRSPIALEATELPEPRPRQLLLLLLLLLPLTLVLLAAAWGLRWQRARRRGELHPGVPLPSHP
• Target-Kategorie: Flt-3 Ligand