Recombinant Mouse Midkine protein(N-His)

Artikelnummer: ELA-PKSM041513
Artikelname: Recombinant Mouse Midkine protein(N-His)
Artikelnummer: ELA-PKSM041513
Hersteller Artikelnummer: PKSM041513
Alternativnummer: ELA-PKSM041513-100, ELA-PKSM041513-20
Hersteller: Elabscience
Kategorie: Proteine/Peptide
Spezies Reaktivität: Mouse
Alternative Synonym: IP-10,Gamma-Interferon Inducible Protein 10,Crg-2
Tag: N-His
NCBI: 12025
UniProt: P12025
Expression System: E.coli
Reinheit: > 98 % as determined by reducing SDS-PAGE.
Formulierung: Lyophilized from sterile PBS, pH 7.4Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual.
Sequenz: MQHRGFFLLALLALLVVTSAVAKKKEKVKKGSECSEWTWGPCTPSSKDCGMGFREGTCGAQTQRVHCKVPCNWKKEFGADCKYKFESWGACDGSTGTKARQGTLKKARYNAQCQETIRVTKPCTSKTKSKTKAKKGKGKD
Target-Kategorie: Midkine