Recombinant Swine IL-8 protein(N-His)(active)
Artikelnummer:
ELA-PKSS000006
- Bilder (0)
| Artikelname: | Recombinant Swine IL-8 protein(N-His)(active) |
| Artikelnummer: | ELA-PKSS000006 |
| Hersteller Artikelnummer: | PKSS000006 |
| Alternativnummer: | ELA-PKSS000006-20, ELA-PKSS000006-5 |
| Hersteller: | Elabscience |
| Kategorie: | Proteine/Peptide |
| Applikation: | Cell Culture |
| Spezies Reaktivität: | Porcine |
| Alternative Synonym: | Monocyte-Derived Neutrophil Chemotactic Factor (MDNCF),Neutrophil Activating Factor (NAF),AMCF-I,CXCL8 |
| Tag: | C-His |
| NCBI: | 26894 |
| UniProt: | P26894 |
| Expression System: | E.coli |
| Reinheit: | > 98 % as determined by reducing SDS-PAGE. |
| Formulierung: | Lyophilized from sterile PBS, pH 7.4Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequenz: | MTSKLAVAFLAVFLLSAALCEAAVLARVSAELRCQCINTHSTPFHPKFIKELRVIESGPHCENSEIIVKLVNGKEVCLDPKEKWVQKVVQIFLKRTEKQQQQQ |
| Target-Kategorie: | IL-8 |
Produktgarantie und fachkundiger Support
