Recombinant Swine BMP-4 protein(N-His)

Produktübersicht

• Artikelname: Recombinant Swine BMP-4 protein(N-His)
• Artikelnummer: ELA-PKSS000011
• Hersteller Artikelnummer: PKSS000011
• Alternativnummer: ELA-PKSS000011-20, ELA-PKSS000011-5
• Hersteller: Elabscience
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Porcine
• Alternative Synonym: Bone morphogenetic protein 4,Bone morphotic protein 4,BMP4

Produkteigenschaften

• Tag: N-His
• NCBI: 7
• UniProt: A7LJT9
• Expression System: E.coli
• Reinheit: > 98 % as determined by reducing SDS-PAGE.
• Formulierung: Lyophilized from a solution containing 20 mM sodium citrate, 0.2 M NaCl, pH 3.5.Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual.
• Sequenz: MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEEQTHSVGLEYPERPASRANTVRSFHHEEHLENIPGTSENSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWEQGFHRINIYEVMKPPPEVVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRWTREKQPNYGLAIEVTHLHQTRTHQGQHVR
• Target-Kategorie: BMP-4