Recombinant Swine IFN gamma protein(N-His)(active)
Artikelnummer:
ELA-PKSS000012
- Bilder (0)
| Artikelname: | Recombinant Swine IFN gamma protein(N-His)(active) |
| Artikelnummer: | ELA-PKSS000012 |
| Hersteller Artikelnummer: | PKSS000012 |
| Alternativnummer: | ELA-PKSS000012-20, ELA-PKSS000012-5 |
| Hersteller: | Elabscience |
| Kategorie: | Proteine/Peptide |
| Applikation: | Cell Culture |
| Spezies Reaktivität: | Porcine |
| Alternative Synonym: | IFN-gamma,IFNG |
| Tag: | N-His |
| NCBI: | 17803 |
| UniProt: | P17803 |
| Expression System: | E.coli |
| Reinheit: | > 95 % as determined by reducing SDS-PAGE. |
| Formulierung: | Lyophilized from sterile PBS, pH 7.4Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequenz: | MSYTTYFLAFQLCVTLCFSGSYCQAPFFKEITILKDYFNASTSDVPNGGPLFLEILKNWKEESDKKIIQSQIVSFYFKFFEIFKDNQAIQRSMDVIKQDMFQRFLNGSSGKLNDFEKLIKIPVDNLQIQRKAISELIKVMNDLSPRSNLRKRKRSQTMFQGQRASK |
| Target-Kategorie: | IFN gamma |
Produktgarantie und fachkundiger Support
