Recombinant Swine IGF-I protein(N-His)

Produktübersicht

• Artikelname: Recombinant Swine IGF-I protein(N-His)
• Artikelnummer: ELA-PKSS000020
• Hersteller Artikelnummer: PKSS000020
• Alternativnummer: ELA-PKSS000020-20, ELA-PKSS000020-5
• Hersteller: Elabscience
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Porcine
• Alternative Synonym: Somatamedin C,IGF-IA,Npt2B

Produkteigenschaften

• Tag: N-His
• NCBI: 16545
• UniProt: P16545
• Expression System: E.coli
• Reinheit: > 98 % as determined by reducing SDS-PAGE.
• Formulierung: Lyophilized from sterile PBS, pH 8.0Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual.
• Sequenz: MGKISSLPTQLFKCCFCDFLKVKMHITSSSHLFYLALCLLSFTSSATAGPETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKAQKEVHLKNTSRGSSGNKNYRM
• Target-Kategorie: IGF-I