Recombinant Swine CXCL9 protein(N-His)
Artikelnummer:
ELA-PKSS000021
- Bilder (0)
| Artikelname: | Recombinant Swine CXCL9 protein(N-His) |
| Artikelnummer: | ELA-PKSS000021 |
| Hersteller Artikelnummer: | PKSS000021 |
| Alternativnummer: | ELA-PKSS000021-20, ELA-PKSS000021-5 |
| Hersteller: | Elabscience |
| Kategorie: | Proteine/Peptide |
| Spezies Reaktivität: | Porcine |
| Alternative Synonym: | C-X-C motif chemokine 9,Gamma-interferon-induced monokine,Monokine induced by interferon-gamma,MIG,MuMIG,Protein m119,Small-inducible cytokine B9,Cxcl9,Mig,Scyb9 |
| Tag: | N-His |
| NCBI: | 0 |
| UniProt: | A0A4X1SX95 |
| Expression System: | E.coli |
| Reinheit: | > 98 % as determined by reducing SDS-PAGE. |
| Formulierung: | Lyophilized from sterile PBS, pH 7.4Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual. |
| Sequenz: | MKKSSVALLLGIIFLTLIGVQGTLLMRNGRCSCINTSQRMIHLKSLRDLKQFAPSPSCEKMEVIATMKNGDQTCLNPDSPDVKKLIKEWEKQVSLKKKQKKGKKHPKTKKVRKVKKSQRPDQKKMT |
| Target-Kategorie: | CXCL9 |
Produktgarantie und fachkundiger Support
