Recombinant Swine CXCL13 protein(N-His)

Produktübersicht

• Artikelname: Recombinant Swine CXCL13 protein(N-His)
• Artikelnummer: ELA-PKSS000023
• Hersteller Artikelnummer: PKSS000023
• Alternativnummer: ELA-PKSS000023-20, ELA-PKSS000023-5
• Hersteller: Elabscience
• Kategorie: Proteine/Peptide
• Spezies Reaktivität: Porcine
• Alternative Synonym: C-X-C motif chemokine 13,Angie,B cell-attracting chemokine 1,B lymphocyte chemoattractant,CXC chemokine BLC,Small-inducible cytokine B13,BCA1,BLC,SCYB13

Produkteigenschaften

• Tag: N-His
• NCBI: 0
• UniProt: A0A287A706
• Expression System: E.coli
• Reinheit: > 98 % as determined by reducing SDS-PAGE.
• Formulierung: Lyophilized from sterile PBS, pH 7.4Normally 5 % - 8 % trehalose, mannitol and 0.01% Tween80 are added as protectants before lyophilization.Please refer to the specific buffer information in the printed manual.
• Sequenz: MRFTLGSLLLVLLLACSLFPIHGVLETNDTNLKCQCLRSTSNWVPIRLIEKIQIWPPGNGCPTREVIVWMTNKTAICLNPQSKLLQKLINLMWRKKTSTTLPAPVSKKSIA
• Target-Kategorie: CXCL13