E2F1 Antibody, Unconjugated, Rabbit, Polyclonal
Artikelnummer:
FBX-E2F1-101AP
| Artikelname: |
E2F1 Antibody, Unconjugated, Rabbit, Polyclonal |
| Artikelnummer: |
FBX-E2F1-101AP |
| Hersteller Artikelnummer: |
E2F1-101AP |
| Alternativnummer: |
FBX-E2F1-101AP-100 |
| Hersteller: |
FabGennix |
| Wirt: |
Rabbit |
| Kategorie: |
Antikörper |
| Applikation: |
ELISA, WB |
| Spezies Reaktivität: |
Human, Mouse, Rat |
| Immunogen: |
Synthetic peptide corresponding to amino acids 58-93 of Human E2F1. Sequence: PCDPDLLLFATPQAPRPTPSAPRPALGRPPVKRRLD |
| Konjugation: |
Unconjugated |
| Alternative Synonym: |
E2F-1, PBR3, PRB-binding protein E2F-1, RBAP1, RBAP-1, RBBP3, RBBP-3, RBP3, retinoblastoma-associated protein 1, retinoblastoma-binding protein 3, transcription factor E2F1 |
| Klonalität: |
Polyclonal |
| Isotyp: |
IgG |
| NCBI: |
1869 |
| UniProt: |
Q01094 |
| Reinheit: |
Affinity Purified |
| Target-Kategorie: |
E2F1 |
